PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016443010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 88aa    MW: 10177 Da    PI: 9.4409
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016443010.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.6e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+d +   G  +W+++++  g+ R++k+c++rw +yl
   XP_016443010.1 14 KGPWTAEEDKKLIDFILNNGQCCWRAVPKLTGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-21563IPR009057Homeodomain-like
PROSITE profilePS5129420.14965IPR017930Myb domain
SMARTSM007171.0E-111363IPR001005SANT/Myb domain
PfamPF002494.0E-151461IPR001005SANT/Myb domain
SuperFamilySSF466894.42E-191588IPR009057Homeodomain-like
CDDcd001676.42E-91661No hitNo description
Gene3DG3DSA:1.10.10.608.0E-66488IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 88 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAE EDKKLIDFIL NNGQCCWRAV PKLTGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SEYEEKMVID LHAQLGNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-151288580B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2796121e-134AB279612.1 Nicotiana tabacum NtMYBGR1 mRNA for MYB-related transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009616533.11e-61PREDICTED: protein ODORANT1-like
SwissprotQ50EX61e-53ODO1_PETHY; Protein ODORANT1
TrEMBLK4D5R24e-58K4D5R2_SOLLC; Uncharacterized protein
TrEMBLM1B9Y85e-58M1B9Y8_SOLTU; Uncharacterized protein
TrEMBLQ401733e-58Q40173_SOLLC; Myb-related transcription factor
STRINGSolyc11g011050.1.11e-57(Solanum lycopersicum)
STRINGPGSC0003DMT4000404621e-57(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.14e-59myb domain protein 20